If you have been reading about Karl Fischer titration and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-07-16. Numbers and descriptions here follow the published literature rather than marketing material.
Identity and purity are usually assessed with reversed-phase high-performance liquid chromatography, often paired with mass spectrometry using electrospray or MALDI ionisation. Amino acid analysis and peptide mapping by enzymatic digestion provide additional sequence-level confirmation. Purity is commonly reported as an area percentage from a chromatographic trace, and water content can be measured by Karl Fischer titration. Reported masses may differ by tens of daltons between sources because preparations can contain acetate or trifluoroacetate counterions, and such differences are not by themselves evidence of a different peptide.
BPC-157 is normally distributed as a lyophilised powder that ranges from white to off-white in appearance. The peptide dissolves readily in water, normal saline, and common aqueous buffers, and it is poorly soluble in nonpolar solvents such as hexane or vegetable oils. Lyophilised vials take up moisture if left open, which changes the mass of powder in the container and complicates any later weighing. Because the material is handled in small quantities, static and adhesion to glass or plastic can also cause noticeable losses during transfer.
Early work on this family of molecules examined fractions of human gastric juice, where a larger protein was reported to protect gastrointestinal tissue in animal models. BPC 157 was designed as a shorter, more stable fragment of that protein and then studied on its own. The peptide itself is not a normal dietary component and is not present in the human body in meaningful quantities. Descriptions of its origin therefore refer to the research lineage of a laboratory molecule rather than to an endogenous or nutritional substance.
The sequence contains an unusually high proportion of proline and glycine, which limits regular secondary structure and contributes to solubility in aqueous media. The compound dissolves readily in water and in normal saline. Because it is a peptide, digestive enzymes are expected to break it down if it is swallowed, a consideration that influences the routes of administration used in animal experiments. Detailed conformational data remain limited, and published structural models are largely computational.
BPC 157 is a synthetic peptide built from fifteen amino acids. The letters stand for body protection compound, and the number is a laboratory code rather than a description of any biological feature. Its single-letter sequence is GEPPPGKPADDAGLV, which corresponds to a calculated mass near 1419.5 daltons. The material is produced by solid-phase peptide synthesis and is distributed as a lyophilized powder, not as a purified extract from a natural source.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilised material; shade varies slightly between lots |
| Solubility in water | Freely soluble | Dissolves in water, saline, and aqueous buffers |
| Solubility in nonpolar solvents | Poorly soluble | Not compatible with oils or hydrocarbon solvents |
| Typical storage temperature | About −20 °C | Lyophilised, dry, dark storage slows hydrolysis |
| Common purity method | Reversed-phase HPLC | Area percentage, usually paired with mass spectrometry |
BPC-157 is a synthetic pentadecapeptide with the sequence GEPPPGKPADDAGLV, corresponding to a partial fragment of a larger protein detected in human gastric juice. The name derives from the parent protein designation BPC, an abbreviation of body protection compound, with 157 acting as a fraction or batch identifier used by the original investigators. Its molecular weight is approximately 1419 daltons, and the chain contains no unusual residues or disulfide bridges. In the literature it is described as a short, water-soluble fragment rather than a complete natural protein.
Most early work on this peptide originated in the 1990s from a research group in Zagreb, Croatia, relying on animal models and cell cultures. Reported observations included effects on gastrointestinal lesion healing, tendon fibroblast migration, and blood vessel formation under controlled laboratory conditions. These findings come predominantly from rodent studies and in vitro assays rather than from human trials. Controlled human data remain limited, and the degree to which animal results translate to human physiology is an open question rather than a settled fact.
Published studies on BPC-157 are dominated by animal models. Commonly used endpoints include healing of surgically induced lesions in the stomach, tendon-to-bone attachment after transection, and recovery from experimentally induced vascular or intestinal damage. Many of these reports come from a small number of research groups, and the peptide is often described as acting across a wide range of tissue types. That breadth is itself a point of discussion, since one molecule influencing many unrelated systems is unusual.
Human data are far more limited than animal data. A small number of clinical reports exist, generally with few participants and without the randomization or blinding expected in later-phase trials. No large, independently replicated human trial has appeared in the indexed peer-reviewed literature. Statements about effects in people therefore rest on extrapolation from animal work rather than on direct evidence, and the strength of that extrapolation remains an open question rather than a settled matter.
Proposed mechanisms include interaction with the nitric oxide system, modulation of growth factor signaling, and effects on blood vessel formation. None of these has been established as the primary mode of action, and some proposed pathways rest on indirect measurements. Whether the reported effects depend on a specific receptor has not been determined. Stability in gastric acid, unusual for a peptide of this size, is also reported in animal work, but the reason for it is not firmly established.
Most published work on BPC-157 comes from animal experiments rather than controlled human trials. Rodent models have examined its effects on gastrointestinal lesions, tendon and ligament injury, and blood vessel formation. These studies are often small and originate from a limited number of research groups, which affects how broadly the findings can be generalized. No large randomized human trial has been reported in the peer-reviewed literature. Discussion of the compound therefore rests largely on preclinical data, and questions about its effects in people remain open rather than settled.
Several mechanisms have been proposed to explain the activity observed in animal models. The most frequently cited involve signaling through vascular endothelial growth factor receptor 2 and modulation of the nitric oxide system. Researchers have also described interactions with protective pathways in the gut lining. These proposed mechanisms appear in the literature as hypotheses supported by preclinical observations, not as confirmed pathways in humans. The precise way the peptide produces its reported effects, and whether those effects carry across species, remain areas of active and unresolved investigation.
==== Llanos and tropical ecology ==== In February 1800, Humboldt and Bonpland departed the Caribbean coast, setting their sights on the Orinoco River. This important northern neighbor of the Amazon promised a gateway into the equatorial jungles, famed for their extraordinary biodiversity and dense tropical vegetation. For Humboldt, the journey offered a long-awaited opportunity to conduct magnetic measurements at latitudes where Earth’s magnetism would differ significantly from what he had found in Europe. The expedition also carried the excitement of possibly confirming the rumored connection between the Orinoco and Amazon or Rio Negro river systems—a geographical mystery that had fascinated explorers for years. The most direct route from Caracas to the Orinoco would have been to cross the southern mountain chain between Baruta and Salamanca, traverse the savannahs of Ocumare, and embark at Cabruta near the Rio Guarico’s mouth. However, this shortcut would have denied the travelers the chance to survey the most fertile and cultivated regions of the province—the valleys of Aragua—along with valuable opportunities to measure the elevation of the coastal mountain chain by barometer and to descend the Rio Apure to its meeting point with the Orinoco. From Puerto Cabello, Humboldt and Bonpland made their way across the coastal ranges and llanos towards Lake Valencia. The heat was so intense that they often rode at night to avoid the sun’s punishing rays.
=== Role in wound healing === Macrophages are essential for wound healing. They replace polymorphonuclear neutrophils as the predominant cells in the wound by day two after injury. Attracted to the wound site by growth factors released by platelets and other cells, monocytes from the bloodstream enter the area through blood vessel walls. Numbers of monocytes in the wound peak one to one and a half days after the injury occurs. Once they are in the wound site, monocytes mature into macrophages. The spleen contains half the body's monocytes in reserve ready to be deployed to injured tissue. The macrophage's main role is to phagocytize bacteria and damaged tissue, and they also debride damaged tissue by releasing proteases. Macrophages also secrete a number of factors such as growth factors and other cytokines, especially during the third and fourth post-wound days. These factors attract cells involved in the proliferation stage of healing to the area. Macrophages may also restrain the contraction phase. Macrophages are stimulated by the low oxygen content of their surroundings to produce factors that induce and speed angiogenesis and they also stimulate cells that re-epithelialize the wound, create granulation tissue, and lay down a new extracellular matrix. By secreting these factors, macrophages contribute to pushing the wound healing process into the next phase.
=== Maintenance === In the absence of leaks, antifreeze chemicals such as ethylene glycol or propylene glycol may retain their basic properties indefinitely. By contrast, corrosion inhibitors are gradually used up, and must be replenished from time to time. Larger systems (such as HVAC systems) are often monitored by specialist firms which take responsibility for adding corrosion inhibitors and regulating coolant composition. For simplicity, most automotive manufacturers recommend periodic complete replacement of engine coolant, to simultaneously renew corrosion inhibitors and remove accumulated contaminants.
Ross (1952), engineer and managing partner at Jaros, Baum & Bolles William Carl Burger (1953), botanist, curator at the Field Museum of Natural History Gerald Feinberg (1953), physicist who coined the term "tachyon" Bernard Friedland (1953), professor and engineer, New Jersey Institute of Technology, recipient of the 1982 Rufus Oldenburger Medal Arthur Gottlieb (1953), immunologist, professor at Tulane University School of Medicine Eliot S. Hearst (1953), psychologist, professor at Indiana University Charles Kadushin (1953), psychologist at the City University of New York, recipient of the 2009 Marshall Sklare Award Donald R. Olander (1953), professor of nuclear engineering at University of California, Berkeley Nicholas P. Samios (1953), former director of the Brookhaven National Laboratory Melvin Schwartz (1953), winner of the Nobel Prize in Physics in 1988 Wallace Smith Broecker (1953), professor of environmental science at Columbia University, developed the idea of a global "conveyor belt" linking ocean circulation Richard K. Bernstein (1954), physician and advocate for low-carbohydrate diet Henry Buchwald (1954), professor of surgery and biomedical engineering at University of Minnesota Neil D. Opdyke (1955), geologist Alvin F. Poussaint (1956), professor of psychiatry and dean of freshmen at the Harvard Medical School A.
Sources: en.wikipedia.org
Natural opiates: alkaloids contained in the resin of the opium poppy, primarily morphine, codeine, and thebaine, but not papaverine and noscapine which have a different mechanism of action Esters of morphine opiates: slightly chemically altered but more natural than the semi-synthetics, as most are morphine prodrugs, diacetylmorphine (morphine diacetate; heroin), nicomorphine (morphine dinicotinate), dipropanoylmorphine (morphine dipropionate), acetylpropionylmorphine, dibenzoylmorphine, diacetyldihydromorphine; Semi-synthetic opioids: created from either the natural opiates or morphine esters, such as hydromorphone, hydrocodone, oxycodone, oxymorphone, ethylmorphine, buprenorphine and desomorphine; Fully synthetic opioids: such as fentanyl, pethidine, levorphanol, methadone, tramadol, tapentadol, and dextropropoxyphene; Endogenous opioid peptides, produced naturally in the body, such as endorphins, enkephalins, dynorphins, and endomorphins. Endogenous opioids, non-peptide: Morphine, and some other opioids, which are produced in small amounts in the body, are included in this category. Natural opioids, non-animal, non-opiate: the leaves from Mitragyna speciosa (kratom) contain a few naturally occurring opioids, active via Mu- and Delta receptors. Salvinorin A, found naturally in the Salvia divinorum plant, is a kappa-opioid receptor agonist. Tramadol and tapentadol, which act as monoamine uptake inhibitors also act as mild and potent agonists (respectively) of the μ-opioid receptor. Both drugs produce analgesia even when naloxone, an opioid antagonist, is administered.
== History == The neurotoxin was reported in 1983 when researchers studied the snake venom for their effects on neuromuscular transmission. Since then, it has contributed to the knowledge about synaptic transmission, cholinergic synapses, and nicotinic acetylcholine receptors (nAChRs). κ-Bungarotoxin is still widely used in research due to its specificity to various nAChRs. The toxin got the kappa in its name as reference to the Latin word kiliaris, which means "related to the eye", from which the ciliary ganglion got its name. Two toxins, named "toxin F" and "bungarotoxin 2.1" were identified by protein sequencing the same way as κ-bungarotoxin.
Mergny and Lacroix determined that the addition of a bulky methyl group had a destabilizing effect on the i-motif formation when they compared phosphorothioate, the natural phosphodiester, methylphosphonate, and peptide linkages and determined that only phosphodiester and phosphorothioate oligodeoxynucleotides were capable of forming stable i-motifs.
Sources: en.wikipedia.org
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
Cytochrome c has been used to detect peroxide production in biological systems. As superoxide is produced, the number of oxidised cytochrome c3+ increases, and reduced cytochrome c2+ decreases. However, superoxide is often produced with nitric oxide. In the presence of nitric oxide, the reduction of cytochrome c3+ is inhibited. This leads to the oxidisation of cytochrome c2+ to cytochrome c3+ by peroxynitrous acid, an intermediate made through the reaction of nitric oxide and superoxide. Presence of peroxynitrite or H2O2 and nitrogen dioxide NO2 in the mitochondria can be lethal since they nitrate tyrosine residues of cytochrome c, which leads to disruption of cytochrome c's function as an electron carrier in the electron transport chain.
=== Basketball === The senior men's basketball team dominated European and world basketball during the mid-to-late 1990s and early 2000s, with three EuroBasket titles (1995, 1997, and 2001), two FIBA World Cup titles (1998 and 2002), and a Summer Olympic Games silver medal (1996). The national team started competing internationally in 1995, after a three-year exile, due to a UN trade embargo. During that time, the FR Yugoslavia was not allowed to compete at the 1992 Summer Olympics in Barcelona, the 1993 EuroBasket, and also the 1994 FIBA World Championship, which was originally supposed to be hosted by Belgrade, before being taken away from the city and moved to Toronto, Canada.
Sources: en.wikipedia.org
Lyophilised peptide powders are generally kept frozen or refrigerated, dry, and protected from light. Sealed vials limit moisture uptake and slow hydrolysis. Such guidance comes from general peptide chemistry rather than from stability studies specific to every product.
Reversed-phase HPLC is the standard approach, with purity expressed as a percentage of total peak area. Mass spectrometry confirms the expected molecular mass and can reveal adducts or truncated sequences. Neither method on its own establishes biological activity.
Small mass differences often reflect different counterions, such as acetate versus trifluoroacetate, or bound water rather than a different amino acid sequence. Mass spectrometry can distinguish these forms when the ionisation conditions are known. Exact sequence confirmation requires peptide mapping or tandem mass spectrometry.
It is a synthetic peptide. Its design was inspired by a fragment of a protein found in human gastric juice, but the fifteen-amino-acid molecule itself is made in a laboratory and is not a normal component of food or of human tissue in appreciable amounts.