evidence base raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2026-02-05. Anything still debated is marked as such rather than presented as settled.
Once dissolved, the material is considerably less stable than the dry solid. Aqueous solutions are usually kept cold and used within a short window, and neutral or mildly acidic buffers are preferred over strongly alkaline conditions. Freeze-thaw cycles promote aggregation and loss of material to container surfaces, so dividing a batch into single-use aliquots is standard. Adsorption to plastic and glass can lower the measured concentration, meaning solution strength may need rechecking before an experiment.
Identity and purity are established with complementary methods rather than one test. Reverse-phase high-performance liquid chromatography separates the main peak from deletion sequences and oxidized variants, and its area percentage is the usual purity figure. Mass spectrometry confirms the expected molecular mass and can flag truncations or modifications that chromatography alone might miss. Amino acid analysis and peptide mapping add sequence-level confirmation, while residual counter-ion and water content are measured separately.
BPC-157 is a synthetic peptide of fifteen amino acids, written as GEPPPGKPADDAGLV, whose sequence matches part of a larger protein identified in human gastric juice. That parent protein was described in stomach-secretion research, and the fifteen-residue fragment was named body protection compound, which gives the peptide its common label. Material used in experiments is produced by solid-phase peptide synthesis rather than extracted from tissue. The reported molecular weight is about 1419 daltons, and the chain contains several proline residues, a feature that appears in discussions of its resistance to enzymatic breakdown.
Most published findings come from rodent models, where the peptide has been examined in wound-healing, gastrointestinal-lesion, tendon, and vascular-injury preparations. A smaller number of early human studies have been reported, chiefly in inflammatory bowel conditions, but the public record is short and has not led to marketing approval in the United States or the European Union. Reviewers therefore classify the compound as investigational, and whether animal results carry over to people remains an open question rather than a settled one.
Outside laboratory supply channels, the peptide is sold as a research chemical, a category that carries no requirement to demonstrate purity, identity, or freedom from contamination. Because it is not an approved medicine, products labeled BPC-157 sit in a regulatory gap in many countries, and actual content may differ from the label. Sports organizations list it among prohibited substances, so its presence in an athlete's sample can produce a doping finding regardless of how the material was obtained.
| Property | Value | Notes |
|---|---|---|
| Dry powder storage | -20 °C or below | Desiccated and protected from light |
| Solution storage | 2-8 °C, short term | Aliquot to avoid freeze-thaw cycling |
| Reconstitution solvent | Water or buffered saline | Near-neutral pH is generally preferred |
| Identity confirmation | Mass spectrometry | Matches expected monoisotopic mass |
| Purity assessment | Reverse-phase HPLC | Reported as main-peak area percentage |
Proposed mechanisms in the literature involve the nitric oxide system, vascular endothelial growth factor signaling, and epidermal growth factor receptor pathways. Some studies report changes in blood vessel formation or in inflammatory mediators, while others describe interactions with nervous tissue. Much of this evidence rests on molecular markers in cultured cells or animal models. Whether the same pathways operate the same way in humans has not been established. Authors therefore tend to describe mechanisms as hypothetical rather than settled.
Direct human evidence is scarce. One trial in ulcerative colitis delivered the compound by enema and produced limited publicly reported results without a clear benefit. The compound is not an approved medicine in most jurisdictions. In many markets it is sold as a research chemical; in others it falls under prescription or controlled categories. Regulators have not confirmed any claimed medical use, and product labels rarely undergo premarket review.
Most published reports describe experiments in rodents rather than in people. These studies examine outcomes in tendons, ligaments, bone, stomach lining, and intestinal tissue. In rat and mouse models, a frequently reported effect is faster healing or reduced damage. Sample sizes are usually small, and a substantial share of the work originates from a small number of research groups. Independent replication is limited, so how far the findings extend to humans remains an open question.
Lyophilized peptide is normally kept at minus twenty degrees Celsius or colder, away from light and moisture. Powder held under those conditions is widely treated as stable for long periods, although published stability studies for this exact sequence are sparse and often come from suppliers rather than independent laboratories. Once dissolved, solutions are generally handled cold and used within a short window, because peptide bonds can hydrolyze over time. Repeated freeze-thaw cycles are usually avoided to limit losses, and exact shelf-life figures depend on the buffer and the concentration involved.
Purity is ordinarily reported as a percentage from reverse-phase high-performance liquid chromatography, where the area of the main peak is compared with the total peak area. Identity is confirmed by mass spectrometry, since the measured mass can be checked against the value calculated from the sequence. Some certificates also include amino acid analysis or sequence confirmation by tandem mass spectrometry. A single purity number does not describe the profile of related impurities, so the underlying chromatogram and spectrum usually carry more information than the headline figure.
Material of this kind is sold for laboratory research, and labels typically state that it is not intended for human or veterinary use. In many countries it is not an approved medicine, and sports antidoping rules place it among prohibited non-approved substances. Buyers commonly review a certificate of analysis, an independent test report, and the declared storage conditions. Batch-to-batch variation in purity and in counterion content is possible, and how much that variation affects experimental outcomes remains an open question.
However, Nikau asks Tane to come to the Bay to take care of him. Ari believes Tane is a bad influence on Nikau, and when asked if he felt the same way, Browne stated: "I can understand why he thinks that. Ari knows that Tane does dodgy things to make a living, because that's what Ari used to do. So I guess Ari is worried that Nikau's going to follow in Tane's footsteps, in the same way that Tane followed in his..."
=== Differential diagnosis === The differential diagnosis for heel pain is extensive and includes pathological entities including: calcaneal stress fracture, septic arthritis, calcaneal bursitis, osteoarthritis, spinal stenosis involving the nerve roots of lumbar spinal nerve 5 (L5) or sacral spinal nerve 1 (S1), calcaneal fat pad syndrome, metastasized cancers from elsewhere in the body, hypothyroidism, gout, seronegative spondyloparthopathies such as reactive arthritis, ankylosing spondylitis, or rheumatoid arthritis (more likely if pain is present in both heels), plantar fascia rupture, and compression neuropathies such as tarsal tunnel syndrome or impingement of the medial calcaneal nerve. Diagnosis can usually be made based on medical history and physical examination. When a physician suspects a fracture, infection, or some other serious underlying condition, an X-ray is typical. X-rays are otherwise unnecessary.
Other common symptoms which come on rapidly include neuromuscular symptoms, shock, loss of consciousness, hypotension, pallor, ataxia, excessive salivation (oral secretions may become profuse and thick), limb paralysis, nausea and vomiting, ptosis, fever, and severe abdominal pain. Local tissue damage appears to be relatively infrequent and of minor severity in most cases of black mamba envenomation. Edema is typically minimal. Acute kidney injury has been reported in a few cases of black mamba bites in humans as well as in animal models. Death is due to suffocation resulting from paralysis of the respiratory muscles. Untreated black mamba bites have a mortality rate of 100%. Antivenom therapy is the mainstay of treatment for black mamba envenomation. A polyvalent antivenom produced by the South African Institute for Medical Research (SAIMR) is used to treat all black mamba bites from different localities. Because of the availability of antivenom, a bite from a black mamba no longer results in certain death, but in order for the antivenom therapy to be successful, vigorous treatment and large doses of antivenom must be administered rapidly post-envenomation. In case studies of black mamba envenomation, respiratory paralysis has occurred in less than 15 minutes. Envenomation by this species invariably causes severe neurotoxicity because black mambas often strike repeatedly in a single lunge. The doses of antivenom required are often massive (10–30+ vials) for bites from this species.
Sources: en.wikipedia.org
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Annular lichen planus Atrophic lichen planus Bullous lichen planus (vesiculobullous lichen planus) Erosive lichen planus Erythema dyschromicum perstans (ashy dermatosis, dermatosis cinecienta) Giant cell lichenoid dermatitis Hepatitis-associated lichen planus Hypertrophic lichen planus (lichen planus verrucosus) Idiopathic eruptive macular pigmentation Inverse lichen planus Keratosis lichenoides chronica (Nékam's disease) Kraurosis vulvae Lichen nitidus Lichen planus actinicus (actinic lichen nitidus, actinic lichen planus, lichen planus atrophicus annularis, lichen planus subtropicus, lichen planus tropicus, lichenoid melanodermatitis, lichenoid melanodermatosis, summertime actinic lichenoid eruption) Lichen planus pemphigoides Lichen planus pigmentosus Lichen planus–lichen sclerosus overlap syndrome Lichen ruber moniliformis Lichen sclerosus (lichen sclerosus et atrophicus) Lichen striatus (Blaschko linear acquired inflammatory skin eruption, linear lichenoid dermatosis) Lichen verrucosus et reticularis Lichenoid trikeratosis Lichenoid dermatitis Lichenoid reaction of graft-versus-host disease Linear lichen planus Mucosal lichen planus Peno-gingival syndrome Ulcerative lichen planus Vulvovaginal gingival syndrome Vulvovaginal lichen planus
=== Condom use === One Australian study of 184 men looked at penis length and circumference in relation to condom breakage or slippage. 3,658 condoms were used. The study found that when used correctly, condoms had a breakage rate of 1.34% and a slippage rate of 2.05%, for a total failure rate of 3.39%. Penile dimensions did not influence slippage, although penis circumference and broken condoms were strongly correlated, with larger sizes increasing the rate of breakage.
King also encouraged private importers and traders, opened a public brewery in 1804, and introduced a schedule of values for Indian copper and Spanish pieces of eight which were used as currency. There was still a serious problem keeping the coin in the colony, despite it being valued higher than its face value. King's actions were not wholly effective but they still antagonised officers of the Corps. Like Hunter, he was the subject of pamphlets and attacks. King tried, unsuccessfully, to court-martial the officers responsible.
Sources: en.wikipedia.org
The list of all companies that have been included in the BSE SENSEX from its inception in 1986 are listed below. The base year of SENSEX is 1978–79 with a base value of 100. During the introduction of the SENSEX in 1986, some of the companies included in the base calculation in 1979 were removed and new companies were added. The index is revised semi-annually in June and December.
=== Langerhans cell histiocytosis === The presence of multiple histiocytomas is now a well recognized syndrome. However, there is yet another presentation in which widespread cutaneous lesions histologically identical to histiocytoma are observed. Clinically, the lesions are almost confluent in affected regions. Rapid internal spread is observed and the affected animals have all been euthanized. There is one published account of such a case, and we have data on 3 dogs with what appears to be an identical syndrome.
=== Pyrrolidines and Pyrrolidinophenones === Pyrrolidines are amphetamines with a pyrrolidine group. Pyrrolidinophenones (also called Pyrovalerones) are cathinones (βk-amphetamines) with a pyrrolidine group.
Sources: en.wikipedia.org
Low temperature slows the chemical reactions, such as oxidation and hydrolysis, that break down a peptide chain. Water and oxygen are the main drivers of degradation, so a cold and dry environment extends usable life. Actual shelf life depends on the batch, the salt form, and the container.
It normally reports the share of the chromatographic signal that belongs to the main peak, not a measure of activity. A high figure means few related substances were detected under the stated method and wavelength. Different laboratories and methods can return different values for the same material.
Retention time alone is weak evidence, because unrelated peptides can elute at similar positions. Amino acid analysis or peptide mapping gives stronger sequence information when a mass spectrometer is unavailable. Most laboratories still treat mass confirmation as the standard step for verifying the correct compound.
It is not approved for human use in the United States or the European Union. Clinical material has been studied in a small number of early trials, mainly for inflammatory bowel conditions, and the compound remains investigational. Regulators treat marketed products as unapproved rather than as authorized drugs.